EUR
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
English English
0 Αντικείμενα
New Products
λεπτομέρειες προιόντος
Handtic Piure (CE) Aroma Flowers XL530 BLACK MADE IN CHINA
Handtic Piure (CE) Aroma Flowers XL530 BLACK MADE IN CHINA
Handtic Piure (CE) Aroma Flowers XL530 BLACK MADE IN CHINA
Handtic Piure (CE) Aroma Flowers XL530 BLACK MADE IN CHINA
Product Code:0M8GdHH
Product Condition:Νέο
5,00 € εισόδημα. φόρος
Add to Cart
Περιγραφή
Updating Order Details
Please do not refresh or navigate away from the page!
Το προϊόν προστέθηκε στο καλάθι σας
x

-------- ή --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i